Сardioprotective agents with biaromatic structure. Part 3. Sodium channel blockers

نویسندگان

چکیده

This review continues a series of reviews on the analysis compounds with cardioprotective properties in number biaromatic structures, which include range sodium channel blockers. Among voltage-gated channels, Nav1.5 isoform is most abundant heart. Sodium blockers have historically been called "class I antiarrhythmics". this type, structure mainly late current belonging to Id subclass antiarrhythmic drugs. Leader molecules from subgroup, such as ranolazine, GS-458967, and F15845, reduce action potential recovery time suppress trigger activity induced by early post-depolarization. They are effective for treatment stable angina ventricular tachycardia.

برای دانلود رایگان متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

Corneal Anesthesia With Site 1 Sodium Channel Blockers and Dexmedetomidine.

PURPOSE Amino-amide or amino-ester local anesthetics, which are currently used for topical ocular anesthesia, are short acting and may delay corneal healing with long-term use. In contrast, site 1 sodium channel blockers (S1SCBs) are potent local anesthetics with minimal adverse tissue reaction. In this study, we examined topical local anesthesia with two S1SCBs, tetrodotoxin (TTX) or saxitoxin...

متن کامل

Structure--activity relationships of hainantoxin-IV and structure determination of active and inactive sodium channel blockers.

Hainantoxin-IV (HNTX-IV) can specifically inhibit the neuronal tetrodotoxin-sensitive sodium channels and defines a new class of depressant spider toxin. The sequence of native HNTX-IV is ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH(2). In the present study, to obtain further insight into the primary and tertiary structural requirements of neuronal sodium channel blockers, we determined the solution ...

متن کامل

Sodium channel blockers are vasodilator as well as natriuretic and diuretic agents.

Amiloride (100-400 micrograms) injected intra-arterially into the dog forelimb perfused at constant flow produced a prompt but transient dose-dependent decrease in perfusion pressure. Intravenous injection lowered systemic arterial pressure, but effects were small and transient except in doses exceeding 10 mg. We tested 11 analogues of amiloride, 3 other diuretics, and a hypotensive imidazopyra...

متن کامل

Severe iatrogenic bradycardia related to the combined use of beta-blocking agents and sodium channel blockers

PURPOSE Drug-induced bradycardia is common during antiarrhythmic therapy; the major culprits are beta-blockers. However, whether other antiarrhythmic drugs are also a significant cause of this, alone or in combination with beta-blockers, is not well known. METHODS We retrospectively investigated the records of all patients hospitalized at our institution for drug-related bradycardia from the ...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

ژورنال

عنوان ژورنال: ??????????????? ? ???????????????

سال: 2022

ISSN: ['2587-7836', '2686-8830']

DOI: https://doi.org/10.37489/2587-7836-2022-3-3-9